PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016473178.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 896aa    MW: 101544 Da    PI: 9.78
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016473178.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.91.6e-1228116298
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     fk+    + ++s+rl++p +fa+++ ++  ++  + le +sg++Wev++    ++g++ l+ GW++F +   +  g f++F ++ rs f  +v++
  XP_016473178.1  28 FKII--FSQHESSRLRIPEDFASRYCKNMLNP--VYLEVPSGEVWEVEV--VHSQGQICLGIGWQDFSDFYSISRGHFLMFGYNARSHF--NVSI 114
                     5655..34556678***********5454444..***************..999999**************************999999..9999 PP

                     E- CS
              B3  97 fr 98 
                     f+
  XP_016473178.1 115 FD 116
                     97 PP

2B341.32.7e-13347434497
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      + ps+vlk  +l+++ kfa+++ +++ +   l+l+ + g sW+v+   + +     +   WkeFv +n+Lk gD++vF++++ s+  + v++f
  XP_016473178.1 347 FMQPSYVLKPYILSISLKFARKYFLESYG--NLVLRVPGGGSWSVTR--TIGTTNAKIY--WKEFVLDNKLKFGDVCVFEVIEGSKLLMDVTIF 434
                     5789*******************888655..6***************..5555444455..*******************99878887777777 PP

3B339.88.3e-13599690599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfr 98 
                     l ps+v+k  +l+++  f +++  ++e++  l+l+ +   sW vk+    ++ ++ ++  Wk Fv +n+Lk gD++vF+l++  s+  l v++fr
  XP_016473178.1 599 LQPSYVSKPYNLRISFLFSRKYF-PEECG-NLVLRVPGRGSWPVKYALGISKTQICFS--WKAFVLDNKLKFGDVCVFELIKGgSKPILDVTIFR 689
                     57899999999**********96.33454.9***************999999999998..********************977688888888887 PP

                     S CS
              B3  99 k 99 
                     +
  XP_016473178.1 690 A 690
                     5 PP

4B351.91.4e-16805890897
                     -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     s+++ + rl++  + a+++ + k++  +++l+ +s rsW vk+i   +     lt+GWkeFv +n+Lk+gD++vF+++ +s+  ++v++f
  XP_016473178.1 805 SSASGTMRLSITLTIARRFFSTKRS--DVVLQVSSKRSWAVKCIL--GTVNAKLTSGWKEFVLDNNLKVGDVCVFERVCTSKLLFNVTIF 890
                     3444448899999999999767555..7***************65..333346***********************99888887777777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-1819118IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-1721118IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.3525118IPR003340B3 DNA binding domain
CDDcd100179.15E-1125116No hitNo description
PfamPF023623.0E-927116IPR003340B3 DNA binding domain
SMARTSM010191.8E-928118IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-16336435IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.83E-17337434IPR015300DNA-binding pseudobarrel domain
CDDcd100172.24E-15342435No hitNo description
SMARTSM010191.5E-11344437IPR003340B3 DNA binding domain
PROSITE profilePS5086310.264344437IPR003340B3 DNA binding domain
PfamPF023621.1E-9347434IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-18587690IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-18588690IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.4E-13594691IPR003340B3 DNA binding domain
PROSITE profilePS5086311.293595691IPR003340B3 DNA binding domain
PfamPF023622.0E-10599690IPR003340B3 DNA binding domain
CDDcd100173.82E-17599689No hitNo description
Gene3DG3DSA:2.40.330.104.3E-23787891IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.29E-19790891IPR015300DNA-binding pseudobarrel domain
CDDcd100171.88E-15793890No hitNo description
SMARTSM010193.7E-10798893IPR003340B3 DNA binding domain
PROSITE profilePS5086312.971798893IPR003340B3 DNA binding domain
PfamPF023624.0E-14804890IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 896 aa     Download sequence    Send to blast
MAAKPQLQRD EGSSHWKSST NITQPKFFKI IFSQHESSRL RIPEDFASRY CKNMLNPVYL  60
EVPSGEVWEV EVVHSQGQIC LGIGWQDFSD FYSISRGHFL MFGYNARSHF NVSIFDLSAS  120
EIEYPYSSAH GIHTPILHCH ETRHAPKRDQ SESDDSVEIL EGIPRSQKAK AIIPDTVEHS  180
VENLGHCPLG QSSKRKRQEG DVEHDVSNDV HVKRMKVEKL QEDVASPSFT REGQKHGEGT  240
VIEHSVEILD HRPSGHGSKR KGLEGDAEDD VSTDIHTRSI KVEKSREDVA SPSFTRKTKE  300
SGERCKMHKQ QSKSVHNQNK TVMDKERAIA YQRAIAFKSK NPFIIAFMQP SYVLKPYILS  360
ISLKFARKYF LESYGNLVLR VPGGGSWSVT RTIGTTNAKI YWKEFVLDNK LKFGDVCVFE  420
VIEGSKLLMD VTIFPAAGRR PMHKIAREEP GFCDSKNKII NTDNFVPCSQ SKIVQTKKLK  480
QQRGEEHGEG TEIEHSVEIL DHRPLGQGSK RKRPEGETKD DVSIDIHTKS IKVENTQEDV  540
ASPSFTRNTK RSEESCRMHK QQSKMVYAKN KTVLDKERSI AYQRAKAFKS ENPFVIYFLQ  600
PSYVSKPYNL RISFLFSRKY FPEECGNLVL RVPGRGSWPV KYALGISKTQ ICFSWKAFVL  660
DNKLKFGDVC VFELIKGGSK PILDVTIFRA AESKPMHKID AKLAGVSDSK KKTIKTENSV  720
PCSQPKIVHS RKLNFEKKQR GDSDCFTSKI KEEFSEDTGK HVQQSKSSCK GSAVAKEMVL  780
AYQRAKAFTS ENPFFIYFMQ PSYVSSASGT MRLSITLTIA RRFFSTKRSD VVLQVSSKRS  840
WAVKCILGTV NAKLTSGWKE FVLDNNLKVG DVCVFERVCT SKLLFNVTIF TSAEGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1556889418144B3 domain-containing transcription factor VRN
4i1k_B2e-1556889418144B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194215RKRQEGDVEHDVSNDVHVKRMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754413e-45HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755143e-45HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016473178.10.0PREDICTED: B3 domain-containing protein Os03g0619600-like
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-18B3 family protein